Role · 11,612 live listings

Backend Engineer jobs

ResuMinder is currently tracking 11,612 backend engineer roles. The median salary range across active listings sits at $158k–$229k, with the top of the band reaching $490k for senior tracks. Employer, Grab and Coinbase Careers Page are the highest-volume hirers in this category this month. The strongest local markets are Berlin, Remote, San Francisco. Use the ResuMinder extension to apply in one click — match your CV in real time and let us auto-fill the application form.

Active roles
11,612

Refreshed continuously

Median salary
$157,519–$229,085

Across active listings

Top of band reaches $490,000 for senior tracks.

Open positions

11,612 live Backend Engineer roles

Back-End Dept Supervisor

Lowe's·Halfmoon, NY 1740

OnsiteFull-time10d ago

Key Responsibilities • Team LeadershipAssigns team members to activities, ensuring staff coverage meets customer demands and redeploying when necessary to support needs throughout the department • May participate in interviews and provide input into selection decisions for new a…

team leadershipperformance coachingcustomer serviceinventory management+11

Senior Software Engineer - Backend (Commerce Team), Hyderabad

Warner Bros Discovery·Hyderabad, Telangāna, India

OnsiteFull-time10d ago

Welcome to Warner Bros. Discovery… the stuff dreams are made of. Who We Are… When we say, “the stuff dreams are made of,” we’re not just referring to the world of wizards, dragons and superheroes, or even to the wonders of Planet Earth. Behind WBD’s vast portfolio of iconic con…

javakubernetesawsdistributed systems+11

Backend Jr Software Developer

Leidos·Gaithersburg, MD

OnsiteFull-time40d ago

Leidos is looking for a Software Developer focusing on System Management supporting our Federal Aviation Administration (FAA) Terminal Flight Data Manager (TFDM) program. The successful candidate will play a crucial role in ensuring the seamless integration and functionality of a…

Lead Full-Stack Engineer - Backend Focus

Humana·Remote, New York

RemoteFull-time17d ago

Become a part of our caring community   The Lead Software Engineer codes software applications based on business requirements. The Lead Software Engineer works on problems of diverse scope and complexity ranging from moderate to substantial. As Centerwell builds its AI engineeri…

typescriptrest api developmentgraphql api developmentapi security+11

Software Engineer Full Stack / Backend II (Full-Time) - United States

Cisco·San Jose, California, United States of America

OnsiteFull-time10d ago

Please note this posting is to advertise potential job opportunities. This exact role may not be open today but could open in the near future. When you apply, a Cisco representative may contact you directly if a relevant position opens. Applications are accepted until further no…

pythonjavagoapi development+11

Senior Software Engineer - Backend Python

BAE Systems·Nashua, New Hampshire, United States

OnsiteFull-time23d ago

Job Description At BAE Systems, we help protect those who protect us. We are seeking a Senior Python Backend Engineer to join our Digital Architecture Team (DAT). In this role, you will be the driving force behind the services that power our digital transformation, building the h…

pythonmicroservices developmentgrpcrestful api development+11

Software Engineer – Backend - Azurion Eye

Philips·Best, Noord-Brabant, Netherlands

OnsiteFull-time102d ago

Job Title Software Engineer – Backend - Azurion Eye Job Description Web Back End Developer Azurion Eye Join Azurion Eye—an integrated, AI‑enabled clinical software platform embedded in the Azurion ecosystem. As Senior Web back‑end developer within the AI Operator domain, you wil…

golangrest api designtechnical leadershipmicroservices architecture+11
LiveKit

Backend Engineer, Real-Time Media

LiveKit·North America / APJ / EMEA

RemoteFull-time$200,000–$300,000/year127d ago

LiveKit is building the infrastructure layer for the voice-driven era of computing. Our platform gives developers everything they need to build, test, deploy, scale, and observe agents in production. Founded in 2021, LiveKit powers voice AI applications for OpenAI, xAI, Salesforc…

EngineeringR&D

Développeur back end (H/F)

PLUS QUE PRO·France (FRF11)

OnsiteFull-time10d ago

Description du poste : Le poste en vrai Tu vas Développer des applications back-end robustes (Laravel/PHP/LAMP)***Intégrer des APIs et services tiers qui déchirent***Chasser les bugs comme un-e pro***Maintenir un code propre avec des tests automatisés***Contribuer à l'open source…

Développeur back end (H/F)

PLUS QUE PRO·France (FRF11)

OnsiteFull-time10d ago

Description du poste : Le poste en vrai Tu vas Développer des applications back-end robustes (Laravel/PHP/LAMP)***Intégrer des APIs et services tiers qui déchirent***Chasser les bugs comme un-e pro***Maintenir un code propre avec des tests automatisés***Contribuer à l'open source…

Backend Engineer (Node.js) (m/w/d) (Informatiker/in)

Hays AG·Germany (DED)

OnsiteFull-time10d ago

Ihre Vorteile: - Du erhälst eine unbefristete Festanstellung und arbeitest in einer 38-Stunden-Woche - Du arbeitest flexibel - ob im Büro oder mobil, du entscheidest (mindestens 1 x pro Woche vor Ort) - Du bekommst 30 Tage Urlaub und an Weihnachten sowie Silvester ist frei - Du p…

Backend Developer (Web Developer)

activjob GmbH·Germany (DE712)

OnsiteFull-time10d ago

Backend Developer Standort: Frankfurt am Main Anstellungsart(en): Vollzeit Beschreibung: Seit vielen Jahren sind wir gelisteter und wertgeschätzter Partner der Deutschen Bahn. Wir bieten für die Deutsche Bahn, projektbezogen, ausgewähltes Fachpersonal mit umfassenden Qualifikatio…

Senior Backend Engineer (m/w/d)

caronsale·Berlin

OnsiteFull-time10d ago

<div class="page"> <div class="section"> <div class="layoutArea"> <div class="column"> <p>You don't want another role where someone else owns the architecture and you own the tickets. Here you pick the technology, design the architecture, and set the standards the backend runs on…

Engineering

Senior Backend Engineer (m/w/d)

caronsale·Munich

OnsiteFull-time10d ago

<div class="page"> <div class="section"> <div class="layoutArea"> <div class="column"> <p>You don't want another role where someone else owns the architecture and you own the tickets. Here you pick the technology, design the architecture, and set the standards the backend runs on…

Engineering

Python Entwickler für Backend Services (m/w/d) (Backend-Entwickler/in)

auteega Gmbh·Germany (DE123)

OnsiteFull-time10d ago

Unser Mandant betreibt ein hochmodernes Dual-Rechenzentrum in der Technologieregion Karlsruhe und steht für höchste Verfügbarkeit, Datensicherheit und leistungsstarke IT-Services. Er unterstützt seine Kunden mit einem breiten Portfolio an Cloud-, IT-, Personalwirtschafts-, Bankin…

(Senior) Backend Engineer (m/w/d) (Backend-Entwickler/in)

Legalhero GmbH·Germany (DE300)

OnsiteFull-time10d ago

What You'll DoBackend engineering at Legal Hero means full ownership. You'll design and run services in our Kotlin/Java stack with Micronaut on AWS, wire LLM capabilities reliably into product flows, harden production systems, and actively shape our testing, deployment, and obser…

Java Entwickler*in (Backend) (Informatiker/in)

Deutsche Rentenversicherung Bund·Germany (DE263)

OnsiteFull-time10d ago

Java Entwickler*in (Backend) Ort Würzburg Vergütung Entgeltgruppe 11 TV EntgO-DRV (55.078,36-81.615,33 Euro) Eintrittsdatum Zum nächstmöglichen Zeitpunkt Beschäftigung Teilzeit, Vollzeit, Unbefristet Bewerbungsfrist 19. Oktober 2026 Ausschreibungsnummer 05-046-2026 Aufgaben In ei…

Java Backend Entwickler*in (m/w/d) (Anwendungsprogrammierer/in)

Hanseatic Bank·Germany (DE600)

OnsiteFull-time43d ago

Spannende Aufgaben warten auf dich - Du arbeitest in einem crossfunktionalen Team, in dem wir alle gemeinsam nach Scrum arbeiten und Agilität wirklich leben. - Du gestaltest, implementierst und betreibst robuste sowie skalierbare Softwarelösungen innerhalb einer modernen Architek…

Backend Engineer - Data (m/f/d)

Alcemy·Berlin, Germany

OnsiteFull-time10d ago

Berlin Mitte · Hybrid (up to 2 days/week remote) · €60,000–75,000 + VSOP equity Help us decarbonize cement and concrete - not tomorrow, today alcemy is on a mission to keep 100 million tons of CO₂ out of the atmosphere every year by 2030. Making concrete accounts for around 8% of…

EngineeringComputer Software

Software-Backend-Entwickler mit Leidenschaft für KI (m/w/x)

siehe Beschreibung·Austria (AT312)

OnsiteFull-time10d ago

Bei EVG drängt es uns ständig zu Neuem. Neugierde ist Teil unserer DNA. Wir suchen Mitarbeiter*innen, die wie wir sind: Denker mit Praxisbezug un... 1 Software-Backend-Entwickler mit Leidenschaft für KI (m/w/x) Standort Linz * Vollzeit 4020 Linz / Industriezeile 54, 5280 Braunau …

Triggerdev

Senior Backend Engineer (Europe)

Triggerdev·Remote or Hybrid UK

HybridFull-time128d ago

ABOUT TRIGGER.DEV Trigger.dev http://Trigger.dev is the platform for running reliable AI agents and workflows. Developers use it to build, deploy, and scale production systems with built-in tools for orchestration, scheduling, monitoring, and debugging. Our Cloud product is a m…

Engineering

Senior Software Engineer, Backend

Brex·Vancouver, British Columbia, Canada

OnsiteFull-time10d ago

Why join us Brex is the intelligent finance platform that enables companies to spend smarter and move faster in more than 200 markets. By combining global corporate cards and banking with intuitive spend management, bill pay, and travel software, Brex enables founders and finance…

Engineering

Software Engineer II, Backend

Brex·Vancouver, British Columbia, Canada

OnsiteFull-time10d ago

Why join us Brex is the intelligent finance platform that enables companies to spend smarter and move faster in more than 200 markets. By combining global corporate cards and banking with intuitive spend management, bill pay, and travel software, Brex enables founders and finance…

Engineering

Senior Software Engineer, Backend (Product Engineering)

Brex·San Francisco, California, United States

OnsiteFull-time10d ago

Why join us Brex is the intelligent finance platform that enables companies to spend smarter and move faster in more than 200 markets. By combining global corporate cards and banking with intuitive spend management, bill pay, and travel software, Brex enables founders and finance…

Engineering

Backend Engineer by city

Narrow by location

Common skills

What employers ask for

Engineeringkubernetespostgresqlpythonjavadistributed systemsmicroservicesgrpckafkatypescriptreactdocker

Get new Backend Engineer jobs by email

Free digest of matching roles. We'll send a quick confirmation first.

Unsubscribe any time. We won't share your email.