Now hiring

Senior Software Technologist – AzurionEye Data Workbench @ Philips

Bangalore, Karnataka, IndiaOnsiteFull-time
Apply with ResuMinder

Opens on the employer's site

About this role

Job Title Senior Software Technologist – AzurionEye Data Workbench Job Description

Senior Software Technologist – Data Workbench

In this role, you will have the opportunity to join the leading innovator in image-guided therapy solutions as Senior Software Technologist for the AzurionEye solution – an integrated, AI-enabled software platform. You will be responsible for product development for a portfolio of REST‑based, microservice‑first applications that power our clinical data lake platform, development of data curation workflows and system software. You will develop a high‑performance, secure, and compliant data warehouse platform and its companion tools for data exploration and data movement (viewing, uploading, downloading). You will pair hands‑on technical depth with system‑level thinking to deliver reliable, scalable data services that power imaging workflows and connected solutions.

You will be part of the Image Guided Therapy Systems business unit with development sites in the Netherlands, China and India. This business unit is responsible for marketing, service, development and manufacturing of solutions and products used in minimally invasive procedures. You will join the global R&D department.

Your Role:

• Acts as the technical coach for a team or domain, being recognized and approached by team members for expertise and guidance, ensures consistent application of best practices and high standards across projects. • Sets quality goals and development practices with the team, driving continuous improvement and excellence in software development through rigorous standards and methodologies. • Integrates software components and third-party libraries into existing systems, ensuring seamless functionality and interoperability with minimal disruption. • Conducts and participates in code reviews, providing constructive feedback to peers and ensuring adherence to coding standards and best practices to maintain code quality. • Analyzes and optimizes application performance, identifying and resolving bottlenecks to enhance user experience and system efficiency, ensuring the software meets performance benchmarks. • Stays current with emerging technologies and industry trends, incorporating new tools and methodologies to improve development processes and product quality. • Develops software to log and store performance data, usage, errors, etc., enabling continuous monitoring of solutions and products for improved reliability and performance. • Collaborates with cross-functional teams, including product managers, designers, and QA engineers, to define, design, and ship new features, ensuring alignment with project goals and user needs. • Resolves a wide range of moderate complexity requests in creative ways, demonstrating good judgment in selecting methods and techniques for obtaining solutions.

You are fit if:

• BE, BTech or MTech in Computer Science/Engineering, Information technology or equivalent • 12-15 years in software development/engineering including requirements analysis, software development, installation, integration, evaluation, enhancement, maintenance, testing, and problem diagnosis/resolution. • Proficiency in leveraging AI-assisted development tools to accelerate design, coding, testing, and documentation with high-quality outcomes. • Thrives in an agile, entrepreneurial, start‑up–like environment with strong ownership, learning mindset and the drive to rapidly iterate, validate and deliver customer centric solutions. • The individual must be able to communicate directions and provide guidance to engineers in the team, as required. • Experience in enterprise application development, design patterns, architectural patterns, OOAD and UML. • Experience building scalable, cloud native data warehouse and relative tools for viewing and uploading/downloading data • Strong proficiency in technology stacks for full stack development – C++, Python, Web (javascript/typescript, CSS, HTML), Microservices, Databases (mongoDB or similar RDBMS) • Hands-on experience in database design, implementation, tuning and migration • Experience with GitHub or Azure Dev Ops • Experience in working on Amazon web services (AWS) is desired. • Experience in automation test frameworks like Cucumber/Salenium, Junit or equivalent is added advantage. • Experience working on CI/CD pipelines like Jenkins is added advantage. • Strong knowledge of all phases of the software development lifecycle • Working experience in SAFe development methodologies • Ability to analyze and solve complex problems. Strong desire to learn and adapt to new technologies and challenges • Ability to identify key technical risks and develop mitigation and recovery plan • Ability to mentor the team technically • Ability to innovate and foster innovation • Extremely good communication and presentation skills • Strong interpersonal and communication skills with the ability to interface in a cross-disciplinary manner, including engineers, product managers, and clinical specialists • Self-motivated individual with good organizational and time management skills • Familiarity with medical devices and/or working in a regulated environment a plus

How we work together: We believe that we are better together than apart. For our office-based teams, this means working in-person at least 3 days per week.

Onsite roles require full-time presence in the company’s facilities.

Field roles are most effectively done outside of the company’s main facilities, generally at the customers’ or suppliers’ locations.

This role is an office-based role. About Philips: We are a health technology company. We built our entire company around the belief that every human matters, and we won't stop until everybody everywhere has access to the quality healthcare that we all deserve. Do the work of your life to help the lives of others. • Learn more about our business. • Discover our rich and exciting history. • Learn more about our purpose. If you’re interested in this role and have many, but not all, of the experiences needed, we encourage you to apply. You may still be the right candidate for this or other opportunities at Philips. Learn more about our culture of impact with care here.

#LI-PHILIN

Skills

c++pythonmicroservicesamazon web servicesmongodbrest api developmentjavascripttypescripthtmlcsssqldatabase designdatabase implementationdatabase migrationgithub

Ready to apply?

Install the ResuMinder extension and we'll auto-fill the application in seconds — no rewriting.

See how your CV scores